PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.004G303400.1.p
Common NameSb04g033670, SORBIDRAFT_04g033670
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family MYB
Protein Properties Length: 315aa    MW: 33906.7 Da    PI: 8.8082
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.004G303400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.14.1e-181562148
                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                          +g+WT+eEd+llvd+++  G g+W++ ++  g++R++k+c++rw +yl
  Sobic.004G303400.1.p 15 KGPWTPEEDKLLVDYIQTNGHGSWRLLPKLAGLNRCGKSCRLRWTNYL 62
                          79********************************************97 PP

2Myb_DNA-binding52.41.2e-1668113148
                           TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
       Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                           rg++T+eE++ +v++++  G++ W+ Ia+ ++ gRt++++k++w+++l
  Sobic.004G303400.1.p  68 RGPFTPEEQKSIVQLHAIVGNK-WSMIAAQLP-GRTDNEIKNYWNTHL 113
                           89********************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.9251062IPR017930Myb domain
SuperFamilySSF466891.01E-3112109IPR009057Homeodomain-like
SMARTSM007172.2E-141464IPR001005SANT/Myb domain
PfamPF002491.1E-161562IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-241669IPR009057Homeodomain-like
CDDcd001673.32E-101762No hitNo description
PROSITE profilePS5129426.4763117IPR017930Myb domain
SMARTSM007172.8E-1567115IPR001005SANT/Myb domain
PfamPF002499.0E-1568113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.2E-2770117IPR009057Homeodomain-like
CDDcd001671.29E-1070113No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 315 aa     Download sequence    Send to blast
MGRAPCCDST KGLKKGPWTP EEDKLLVDYI QTNGHGSWRL LPKLAGLNRC GKSCRLRWTN  60
YLRPDIKRGP FTPEEQKSIV QLHAIVGNKW SMIAAQLPGR TDNEIKNYWN THLKKQLRRM  120
GLDEPPPGPA AGSPAARHMA QWETARLQAE ARLSLLATAS SSSGATATAT TAAATTSASS  180
SSTVDLKACC AKPADIFLRL WSSDIGDSFR RSRKTAAAAP AVPALLPPAP VVVKRKQDAM  240
MIKQEAQAPL LGPVGDDSSA ASNETEVAEA LEEYQMFLDF AGEELGLFHG RHGGFSLFPP  300
LDVLAEASLD TAFK*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-28131175108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0386930.0BT038693.1 Zea mays full-length cDNA clone ZM_BFb0309J21 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002452859.10.0hypothetical protein SORBIDRAFT_04g033670
TrEMBLC5XSP60.0C5XSP6_SORBI; Putative uncharacterized protein Sb04g033670
STRINGSb04g033670.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54093157
Representative plantOGRP5171784
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61250.13e-81myb domain protein 17